Rhymes for "rebirth" /ɹibəɹθ/
2 syllables (re-birth)
Looking for words that rhyme with "rebirth"? Here are perfect rhymes and multisyllabic combinations.
Perfect Rhymes for 'rebirth'
These words share the same ending sound from the stressed syllable onward.
earthbirthnew birthmirthworthunearthself-worthrare earthdown-to-earthsalt of the earthdearthgive birthscum of the earthgirthwide berthberthnet worthpot earthfirthunworthtransearthyoung-earthman-of-the-earthprebirthalkaline-earth metalmisbirthmid-earthout-girthungirth
Sound-Alike Rhymes for 'rebirth'
Slant rhymes, assonance rhymes, call it what you want — a very useful tool for songwriters.
Whole-word matches
peoplefreedomedenvenusreasonpreacherbeatlesgeniussneakercreaturepizzarealdemonevilpeacefulsweetestje-susjesuseaglekeeperheathensrebirthre-alsec-retfree-dompeanutdemonsreaderregalregionseasonvivasteeplestreamerjesus'peachesseasonscheaterpleiadssecret'sreapereaglestreasonreaper'sleaderleisurebeaconqueendomreasonsseawardsweetnessthe cupdivahealerbeatlepizza'sreason'yeezusfeverlegionthe touchthe dovegleefulsweetenercheetahpizzasje-zusevilsbeach'szebrateaserdealerweaverfree versegrievousreapersegyptgrievancegenialfree loveevil'sskierdreamerdivasbeavergeishaeagerpeanutsbeach bumbleakestresearchlethalpeace dovesleepercheetahsseasonalmeanestmetafree frombeacons
Split Groupings
Pick a word from each column, left to right, to build your rhyme.
1 + 1
re /ɹi/
leavestreedreamdreamsmealnicethehe'speaceseastreetsqueenreadmemebeegreenscreamssheepseescreendeepmeatbeastsinfeetbeambreathebreezeeatcleanhealsweetteachfreescreamrealfeelthreepiecebeachsleepwheatliefieldneedtweetsshekeykeysdreamedtreesweeteamdream'griefgrievebridepeapeachgreedgleamgleepeepzealgreekkneesgreenskeatswheelsteensteensleepsbeatfriesfeedheelfleetbleedsgeesepleaseseekchiefstreatsfieldsevesweekstealseasecheesechiccreepthiefseathealssteedwreakedtweetbeer'ssweetswreak
birth /bəɹθ/
earththeyougirlworldyou'repearlbirthamwormsworld'burnturntwerkchurchbirdcansureversecursewhenpurrflirtherbskirtverveheardsurfthey'reworstwoulddirgeblurserveshallworkyearnyou'vewerethirstwormsirfirstchirppurpmirthyou'llmergeburstchirpedcouldyearnethirdsternjournallearnburdensearchnerveworthfurfernscourgeturtlecursednurse'causequirkbirchspurswirltwirlwhirlverdantfertilesurfsskurtdosmirksplurgeblurthurtperkchurnwhatversedmerchcurbhurdleurgeslurpturntsurgeburdenednerdspurnedmyrtletheiryourspurred
"rebirth" in Song Lyrics
See how artists use "rebirth" in their lyrics:
People jumpin' from roofs, shotguns pumping, made it through my youth
Walkin' very thin lines, ages seven and nine
That's the age I was on my album cover, this is the rebirth
I know the streets thirst water like Moses
Walkin' through the hot desert, searchin' to be free
We don't die, we, multiply!
You heard the death side
Open your black eyes for the rebirth
Resurrection and rise
Those who desire to supplant God
Illuminati who tempt and horrify us as the most perfect angel Lucifer
Seek to rebirth a new world order upon the flesh, blood, and bones of all humanity
Again, towers rose skyward to challenge his divine glory
To conquer his serene domain
Ready to write?
Lazyjot helps you find rhymes as you write, counts syllables automatically, and highlights your rhyme schemes.
Start writing — it's free